PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1094_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MIKC_MADS
Protein Properties Length: 140aa    MW: 15954.5 Da    PI: 9.5491
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1094_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF80.79.5e-26958150
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                krien  nr vtfskRrng+ KKA+E+ vLCda+va+i+f+s+gk+ +y+
  RrC1094_p2  9 KRIENANNRVVTFSKRRNGLVKKAKEITVLCDAKVALIVFASNGKMTDYC 58
                79*********************************************997 PP

2K-box70.55.2e-2471139169
       K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69 
                 yqk sgk+l++ak+e+l++e++++kke++nLq e+Rhl+Ged++sL+lk+L+ +e+++e++l k+R+++
  RrC1094_p2  71 YQKLSGKKLWDAKHENLSNEIDRIKKENDNLQLELRHLKGEDIQSLNLKNLMAVEHAIEHGLDKVRDHQ 139
                 899***************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.333161IPR002100Transcription factor, MADS-box
SMARTSM004325.6E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-34296IPR002100Transcription factor, MADS-box
CDDcd002653.82E-38280No hitNo description
PRINTSPR004042.0E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.5E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-263859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-1482139IPR002487Transcription factor, K-box
PROSITE profilePS5129711.02284140IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MGRGKIEIKR IENANNRVVT FSKRRNGLVK KAKEITVLCD AKVALIVFAS NGKMTDYCCP  60
SMDLGAMLDQ YQKLSGKKLW DAKHENLSNE IDRIKKENDN LQLELRHLKG EDIQSLNLKN  120
LMAVEHAIEH GLDKVRDHQA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J2e-16289180Myocyte-specific enhancer factor 2A
3p57_I2e-16289180Myocyte-specific enhancer factor 2A
3p57_D2e-16289180Myocyte-specific enhancer factor 2A
3p57_C2e-16289180Myocyte-specific enhancer factor 2A
3p57_B2e-16289180Myocyte-specific enhancer factor 2A
3p57_A2e-16289180Myocyte-specific enhancer factor 2A
3kov_J2e-16289180Myocyte-specific enhancer factor 2A
3kov_I2e-16289180Myocyte-specific enhancer factor 2A
3kov_B2e-16289180Myocyte-specific enhancer factor 2A
3kov_A2e-16289180Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9679620.0KC967962.2 Brassica oleracea var. viridis PI.b (PI.b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001302977.16e-99floral homeotic protein PISTILLATA-like
SwissprotP480078e-99PIST_ARATH; Floral homeotic protein PISTILLATA
TrEMBLA8V3456e-99A8V345_BRANA; PISTILLATA-1
STRINGBra006549.1-P2e-98(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-100MIKC_MADS family protein